PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000152G0440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 469aa    MW: 51266.9 Da    PI: 6.6652
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000152G0440genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.61.2e-24110154145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  PH01000152G0440 110 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 154
                      79****************************************997 PP

2QLQ613.4e-214984237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FTaaQ ++L++Q+l+yKyL+a++P+Pp+Ll++i++
  PH01000152G0440 49 PFTAAQYEELEQQALIYKYLVAGVPIPPDLLLPICR 84
                     9*********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.5E-114884IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1264984IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.8E-154983IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486110154IPR014977WRC domain
PfamPF088795.1E-21111153IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MEMRVGLVID SYNHNELVVI HRDARSRGVG EEAQQHMMSA RWGAARPAPF TAAQYEELEQ  60
QALIYKYLVA GVPIPPDLLL PICRGFDSLA SRFYHRPALG YGSYFGKKLD PEPGRCRRTD  120
GKKWRCSKEA APDSKYCERH MHRGRNRSRK PVETQLVAPH SQQPPAPAPA PASAAAAAGF  180
QNHSLYPAIA NGGGGGCGSA PGLFALGSAA QLHMDNAAPY ATAGGGGSKD LRYSAYGVRS  240
LADEHSQLIT GAMDTCMDNS WRLLPSQTPS FSVSSYPLLG TPSDLDQSTI CSLPKVEREP  300
LSFFGTDFVT VDSAKQENQM LRPFFDEWPK ARDSWPELAD DNSLATQLSI SIPMATSDFS  360
TTSSRSPNGT AAAKLIELLQ LMNLKLKEAC AKNEVEKALL SKKDQEVEKL SEEYSLLDNS  420
LKDANAEMDA LREKMKVLED SESSMKSEEC SFLPCFRKGC SCIRTRDP*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0927400.0FP092740.1 Phyllostachys edulis cDNA clone: bpst40101m24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634332.10.0PREDICTED: growth-regulating factor 3 isoform X1
RefseqXP_015634333.10.0PREDICTED: growth-regulating factor 3 isoform X2
SwissprotQ6AWY60.0GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLA0A0D9W8Z60.0A0A0D9W8Z6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014417-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g51190.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-45growth-regulating factor 5